(data stored in ACNUC7421 zone)

EMBL: CP000247.PE228

CP000247.PE228       Location/Qualifiers
FT   CDS             complement(253892..255238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68268"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A169"
FT                   /protein_id="ABG68268.1"
FT                   /translation="MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDAQGDFFWG
FT                   FTELSINTELLAQGKIMIDRAAGCMPDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLA
FT                   LPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHTDEGDEQPVGLGQLIPRIVSGADD
FT                   LSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEVQGLLATRAADLA
FT                   GRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTFI
FT                   EGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATIND
FT                   PTLLQSCKLVLAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPR
FT                   QLPYHEGYVYFELEKGTPAWQDVIKAGALALHISGSFPDLNLQLWAIRG"
     MATMKNKVIW QEGLFALPQH FQQQQRHCEY LLTRRLDAQG DFFWGFTELS INTELLAQGK        60
     IMIDRAAGCM PDGTVFSIPD QDLLPEPFQP GTLSSKESHN IYLALPVISD VINEIQGLHS       120
     AGQGTERYRL THTRVRDFHT DEGDEQPVGL GQLIPRIVSG ADDLSAMVTL PLCRILNKNA       180
     TGALVLDNTF IPTIQAVRVS GLLGAFSGEV QGLLATRAAD LAGRIGSPEQ SGIADVAEFM       240
     MLQMLNRYQM QFTHRSQLHT LHPEAFYRDL VGLLGELMTF IEGNRLPCTV EPYNHRDLTA       300
     TFTRTVIPEL RRALNTVLVP RAQNLPLFFS EGTWIATIND PTLLQSCKLV LAVRARMPYD       360
     QVQRQFIQQS KVAATDKIRS VVSVQVPGIP LHTLTAAPRQ LPYHEGYVYF ELEKGTPAWQ       420
     DVIKAGALAL HISGSFPDLN LQLWAIRG                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page