(data stored in ACNUC7421 zone)

EMBL: CP000247.PE233

CP000247.PE233       Location/Qualifiers
FT   CDS             complement(259919..260344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68273"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1A7"
FT                   /protein_id="ABG68273.1"
FT                   /translation="MQRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLN
FT                   TRSGSCYGSPELGITDLNDESLASSDFRREIRKSISQCILHYEPRITDVVVTAAAPDEY
FT                   APVELRFHIVATIDVSKTKGVFEFDILLDNHQRYCVE"
     MQRRDSGPTG SLFERIREAA NPPSYQNPKE ALIRSIRRNL RQVLNTRSGS CYGSPELGIT        60
     DLNDESLASS DFRREIRKSI SQCILHYEPR ITDVVVTAAA PDEYAPVELR FHIVATIDVS       120
     KTKGVFEFDI LLDNHQRYCV E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page