(data stored in ACNUC7421 zone)

EMBL: CP000247.PE235

CP000247.PE235       Location/Qualifiers
FT   CDS             complement(261856..262359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68275"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A192"
FT                   /protein_id="ABG68275.1"
FT                   /translation="MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLK
FT                   GKPDNTPLDERTAIAINRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDD
FT                   LSPDHIASQVPEIKRLLELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGI
FT                   AVQK"
     MSKMNNNGGS VAPKERISVR YTPKVDGVAA DIELPLNLLI TGNLKGKPDN TPLDERTAIA        60
     INRYNLNAVI SEADIEREFV VPAELSDAPN EQMYVNLKVK SMDDLSPDHI ASQVPEIKRL       120
     LELREALVAL KSPLGNIPAF RAQLQALLEN EDTREQLIQE LGIAVQK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page