(data stored in ACNUC7421 zone)

EMBL: CP000247.PE237

CP000247.PE237       Location/Qualifiers
FT   CDS             263804..265786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0240"
FT                   /product="Vgr-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68277"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A184"
FT                   /protein_id="ABG68277.1"
FT                   /translation="MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDS
FT                   FMQTAEMLLEKKATLTIWQGVIPQRYVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGL
FT                   RQNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDHPAREFCVQYGESDLAFLARLWAE
FT                   EGIFFFERFAADSPEQKLTLCDDVAGLSQAGEFPFNPDASTGAETECVSMFRYEAHVRP
FT                   SSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMESL
FT                   RSDAEKATGQSNSPKLWPGTRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGT
FT                   TLGNQLEVIPADRTWRPRLQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYN
FT                   PATEASSCWVRVSQAWAGPGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSP
FT                   GSLPGTKTQMTIRSKTYKGSGFNELRFEDATGGEQVYIHAQKNMDTEVLNNRTTDVKAD
FT                   HTETIGNDQKITVGLGQTVNVGSKKEGGHDQKVTVANDQHLTIKNDRHKVVNNNQTSKV
FT                   TGTDTEEVVKKQSIKIGDNYELKVEHGTNIISGDSIELICGQGESGTCSIKLEKTGKII
FT                   IRGTEFLFEATGPVDIKGKDIHLNG"
     MSLKGLRFTL EVDGQEPDTF AVVNFRLIQN QSYPFVMSVD VASDSFMQTA EMLLEKKATL        60
     TIWQGVIPQR YVTGVVAGFG MQENNGWQMR YHLRIEPPLW RCGLRQNFRI FQQQDIRTIS       120
     ATLLNENGVT EWTPLFYEDH PAREFCVQYG ESDLAFLARL WAEEGIFFFE RFAADSPEQK       180
     LTLCDDVAGL SQAGEFPFNP DASTGAETEC VSMFRYEAHV RPSSVQSQDY TFKVPDWPGM       240
     YEQQGESLNG QLEQYEIFDY PGRFKDEQHG KDFTLYQMES LRSDAEKATG QSNSPKLWPG       300
     TRFTLTGHPQ KMLNREWQVV QSILSGDQPQ ALHGSQGRGT TLGNQLEVIP ADRTWRPRLQ       360
     SKPKVDGPQS AIVTGPAGEE IFCDEHGRVR VKFHWDRYNP ATEASSCWVR VSQAWAGPGF       420
     GNLAIPRVGQ EVIVDFLNGD PDQPIIMGRT YHEDNRSPGS LPGTKTQMTI RSKTYKGSGF       480
     NELRFEDATG GEQVYIHAQK NMDTEVLNNR TTDVKADHTE TIGNDQKITV GLGQTVNVGS       540
     KKEGGHDQKV TVANDQHLTI KNDRHKVVNN NQTSKVTGTD TEEVVKKQSI KIGDNYELKV       600
     EHGTNIISGD SIELICGQGE SGTCSIKLEK TGKIIIRGTE FLFEATGPVD IKGKDIHLNG       660
//

If you have problems or comments...

PBIL Back to PBIL home page