(data stored in ACNUC7421 zone)

EMBL: CP000247.PE243

CP000247.PE243       Location/Qualifiers
FT   CDS             269887..270390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B8"
FT                   /protein_id="ABG68283.1"
FT                   /translation="MVDIVEADKTDIYFIQESVYGKIGLPAFGNTIGPSAQQVVKKVFA
FT                   VVKERDKTHAKQRLLLEYNGNKLWMNAIDGSEAILPTEFSKRYELSLFNTTNFGEDPFP
FT                   DVNLYNNMKSSFFVRFGGTSHPEAWAIYNASTKEVKYIETAREIDKIFSDFNLSGTLPI
FT                   HIGQ"
     MVDIVEADKT DIYFIQESVY GKIGLPAFGN TIGPSAQQVV KKVFAVVKER DKTHAKQRLL        60
     LEYNGNKLWM NAIDGSEAIL PTEFSKRYEL SLFNTTNFGE DPFPDVNLYN NMKSSFFVRF       120
     GGTSHPEAWA IYNASTKEVK YIETAREIDK IFSDFNLSGT LPIHIGQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page