(data stored in ACNUC7421 zone)

EMBL: CP000247.PE252

CP000247.PE252       Location/Qualifiers
FT   CDS             278865..279362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68292"
FT                   /db_xref="GOA:A0A454A1B7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B7"
FT                   /protein_id="ABG68292.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLQNRRNQLLTTQFQTLRNVIIKVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIR
FT                   NTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVAKGLYPIDWAGDVTDFSAGERI
FT                   IL"
     MSEYRRYYIK GGTWFFTVNL QNRRNQLLTT QFQTLRNVII KVKRDRPFEI NAWVVLPEHM        60
     HCIWTLPEGD DDFSSRWREI KKQFTHACGL KNIWQPRFWE HAIRNTKDYR HHVDYIYINP       120
     VKHGWVKQVS DWPFSTFHRD VAKGLYPIDW AGDVTDFSAG ERIIL                       165
//

If you have problems or comments...

PBIL Back to PBIL home page