(data stored in ACNUC7421 zone)

EMBL: CP000247.PE256

CP000247.PE256       Location/Qualifiers
FT   CDS             282222..283277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0260"
FT                   /product="DNA-damage-inducible protein P (DinP)"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68296"
FT                   /db_xref="GOA:Q0TL85"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TL85"
FT                   /protein_id="ABG68296.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKSDLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
     MRKIIHVDMD CFFAAVEMRD NPALRDIPIA IGGSRERRGV ISTANYPARK FGVRSAMPTG        60
     MALKLCPHLT LLPGRFDAYK EASNHIREIF SRYTSRIEPL SLDEAYLDVT DSVHCHGSAT       120
     LIAQEIRQTI FNELQLTASA GVAPVKFLAK IASDMNKPNG QFVITPAEVP AFLQTLPLAK       180
     IPGVGKVSAA KLEAMGLRTC GDVQKCDLVT LLKRFGKFGR ILWERSQGID ERDVNSERLR       240
     KSVGVERTMA EDIHHWSECE AIIERLYPEL ERRLAKVKPD LLIARQGVKL KFDDFQQTTQ       300
     EHVWPRLNKS DLIATARKTW DERRGGRGVR LVGLHVTLLD PQMERQLVLG L                351
//

If you have problems or comments...

PBIL Back to PBIL home page