(data stored in ACNUC7421 zone)

EMBL: CP000247.PE266

CP000247.PE266       Location/Qualifiers
FT   CDS             complement(290492..291547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0270"
FT                   /product="outer membrane pore protein E precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68306"
FT                   /db_xref="GOA:A0A454A193"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A193"
FT                   /protein_id="ABG68306.1"
FT                   /translation="MKKSTLALVVMGIVASVSVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLNLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPISGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYVDVGATYYFNKNMSAFVDYKINQLESDNKLNINND
FT                   DIVAVGMTYQF"
     MKKSTLALVV MGIVASVSVQ AAEIYNKDGN KLDVYGKVKA MHYMSDNDSK DGDQSYIRFG        60
     FKGETQINDQ LTGYGRWEAE FAGNKAESDT AQQKTRLAFA GLKYKDLGSF DYGRNLGALY       120
     DVEAWTDMFP EFGGDSSAQT DNFMTKRASG LATYRNTDFF GVIDGLNLNL QYQGKNENRD       180
     VKKQNGDGFG TSLTYDFGGS DFAISGAYTN SDRTNEQNLQ SRGTGKRAEA WATGLKYDAN       240
     NIYLATFYSE TRKMTPISGG FANKTQNFEA VAQYQFDFGL RPSLGYVLSK GKDIEGIGDE       300
     DLVNYVDVGA TYYFNKNMSA FVDYKINQLE SDNKLNINND DIVAVGMTYQ F                351
//

If you have problems or comments...

PBIL Back to PBIL home page