(data stored in ACNUC7421 zone)

EMBL: CP000247.PE280

CP000247.PE280       Location/Qualifiers
FT   CDS             304806..305861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0285"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68320"
FT                   /db_xref="GOA:A0A454A1D3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1D3"
FT                   /protein_id="ABG68320.1"
FT                   /translation="MVYVLIRLVTYGYYRQISEETLVRGARASSYFMESLYGIATVKIQ
FT                   GMVGIRGTHWLNLKIDAINSGIKLTRMDLLFGGINTFVAACDQMAILWLGASLVIDNQM
FT                   TIGMFVAFGSFRGQFSDRVASLTSFLLQLRIMSLHNERIADIALHEKEEKKPEIEIVAD
FT                   MSPVSLETTDLSYRYDSQSAQVFSGLNLSVAPGESVAITGASGAGKTTLMKVLCGLFEP
FT                   DSGKVLVNGTDIRQLGINNYHRMIACVMQDDRLFSGSIRENICGFAEETDDEWMTECAR
FT                   ASHIHDVIMKMPMGYETLIGELGEGLSGGQKQRIFIARALYRKPGILFMDEATSSLDTE
FT                   SERFVNAAIKK"
     MVYVLIRLVT YGYYRQISEE TLVRGARASS YFMESLYGIA TVKIQGMVGI RGTHWLNLKI        60
     DAINSGIKLT RMDLLFGGIN TFVAACDQMA ILWLGASLVI DNQMTIGMFV AFGSFRGQFS       120
     DRVASLTSFL LQLRIMSLHN ERIADIALHE KEEKKPEIEI VADMSPVSLE TTDLSYRYDS       180
     QSAQVFSGLN LSVAPGESVA ITGASGAGKT TLMKVLCGLF EPDSGKVLVN GTDIRQLGIN       240
     NYHRMIACVM QDDRLFSGSI RENICGFAEE TDDEWMTECA RASHIHDVIM KMPMGYETLI       300
     GELGEGLSGG QKQRIFIARA LYRKPGILFM DEATSSLDTE SERFVNAAIK K                351
//

If you have problems or comments...

PBIL Back to PBIL home page