(data stored in ACNUC7421 zone)

EMBL: CP000247.PE283

CP000247.PE283       Location/Qualifiers
FT   CDS             complement(307422..307892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0288"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68323"
FT                   /db_xref="GOA:A0A454A1F1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1F1"
FT                   /protein_id="ABG68323.1"
FT                   /translation="MSCYMKIYWTRKSIPELSALPPSLRKKNFTDAYNAASSHIEYWIG
FT                   AGVSFISMMILFRVYDFLLPAQDTFPGDIIRSLCVVCPSILIWFQFSVYVMRKYYRHIL
FT                   ERGKETETISERLIREADTREYELWRPVRRFFSIIFLIVLLVCIHSLITTIK"
     MSCYMKIYWT RKSIPELSAL PPSLRKKNFT DAYNAASSHI EYWIGAGVSF ISMMILFRVY        60
     DFLLPAQDTF PGDIIRSLCV VCPSILIWFQ FSVYVMRKYY RHILERGKET ETISERLIRE       120
     ADTREYELWR PVRRFFSIIF LIVLLVCIHS LITTIK                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page