(data stored in ACNUC7421 zone)

EMBL: CP000247.PE284

CP000247.PE284       Location/Qualifiers
FT   CDS             308401..308850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68324"
FT                   /db_xref="InterPro:IPR016957"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1A2"
FT                   /protein_id="ABG68324.1"
FT                   /translation="MDHWPNLLAFHFTLYSAEGNINGQQIHAFCTAFYRQVQEHITERN
FT                   HTASPAPPVVLRWLREQHGGATIRCLLLLSQASICHLRVSATVDEECSQVVDLLQQAWR
FT                   GINAGGQCRVERCFRVTWPDTSEQYVALKTAVQSLIPLVIATIIR"
     MDHWPNLLAF HFTLYSAEGN INGQQIHAFC TAFYRQVQEH ITERNHTASP APPVVLRWLR        60
     EQHGGATIRC LLLLSQASIC HLRVSATVDE ECSQVVDLLQ QAWRGINAGG QCRVERCFRV       120
     TWPDTSEQYV ALKTAVQSLI PLVIATIIR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page