(data stored in ACNUC7421 zone)

EMBL: CP000247.PE287

CP000247.PE287       Location/Qualifiers
FT   CDS             310576..310905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0292"
FT                   /product="major pilu subunit operon regulatory protein
FT                   PapB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68327"
FT                   /db_xref="GOA:A0A454A1B9"
FT                   /db_xref="InterPro:IPR004356"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B9"
FT                   /protein_id="ABG68327.1"
FT                   /translation="MAQHEVITRGGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSD
FT                   RVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDSVSAIA
FT                   EAASL"
     MAQHEVITRG GDAFLLKLRE SALSSGSMSE EQFFLLIGIS SIHSDRVILA MKDYLVSGHS        60
     RKDVCEKYQM NNGYFSTTLG RLTRLNVLVA RLAPYYTDSV SAIAEAASL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page