(data stored in ACNUC7421 zone)

EMBL: CP000247.PE292

CP000247.PE292       Location/Qualifiers
FT   CDS             315887..316411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0297"
FT                   /product="F1C minor fimbrial subunit F precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68332"
FT                   /db_xref="GOA:P13429"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13429"
FT                   /protein_id="ABG68332.1"
FT                   /translation="MKDIIKTVTFSCMLAGSMFVTCHVCAAGSVVNITGNVQDNTCDVD
FT                   INSRNFDVSLGSYDSRQFTAAGDTTPASVFHVGLTSCGSAVRAVKLTFTGTPDNQEAGL
FT                   IQINSINGARGVGIQLLDKDKHELKINVPTTIALMPGTQTIAFYARLKATYLPVKAGNV
FT                   DAVVNFVLDYQ"
     MKDIIKTVTF SCMLAGSMFV TCHVCAAGSV VNITGNVQDN TCDVDINSRN FDVSLGSYDS        60
     RQFTAAGDTT PASVFHVGLT SCGSAVRAVK LTFTGTPDNQ EAGLIQINSI NGARGVGIQL       120
     LDKDKHELKI NVPTTIALMP GTQTIAFYAR LKATYLPVKA GNVDAVVNFV LDYQ             174
//

If you have problems or comments...

PBIL Back to PBIL home page