(data stored in ACNUC7421 zone)

EMBL: CP000247.PE296

CP000247.PE296       Location/Qualifiers
FT   CDS             319076..319627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0301"
FT                   /product="MarR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68336"
FT                   /db_xref="GOA:A0A454A1C5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1C5"
FT                   /protein_id="ABG68336.1"
FT                   /translation="MRTCTQAVCFSNMENNEMNNTDTLEKIIRHQKNKDPAYPFREHLL
FT                   MQLCIRANKRMQDNISEFLGAYGINHSVYMVLTTLFTAESHCLSPSEISQKLQFTRTNI
FT                   TRITDFLEKTGYVKRTDSREDRRAKKISLTSEGMFFIQRLTLAQSMYLKEIWGYLTHDE
FT                   QELFEVINKKLLEHLDDVSS"
     MRTCTQAVCF SNMENNEMNN TDTLEKIIRH QKNKDPAYPF REHLLMQLCI RANKRMQDNI        60
     SEFLGAYGIN HSVYMVLTTL FTAESHCLSP SEISQKLQFT RTNITRITDF LEKTGYVKRT       120
     DSREDRRAKK ISLTSEGMFF IQRLTLAQSM YLKEIWGYLT HDEQELFEVI NKKLLEHLDD       180
     VSS                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page