(data stored in ACNUC7421 zone)

EMBL: CP000247.PE297

CP000247.PE297       Location/Qualifiers
FT   CDS             320121..322298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0302"
FT                   /product="TonB dependent outer membrane siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68337"
FT                   /db_xref="GOA:A0A454A1C7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1C7"
FT                   /protein_id="ABG68337.1"
FT                   /translation="MRINKILWSLTVLLVGLNSQVSVAKYSDDDNDETLVVEATAEQVL
FT                   KQQPGVSVITSEDIKKTPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPEN
FT                   TLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEQVERIEVIRGPAAARYGSGAAGG
FT                   VVNIITKRPTNDWHGSLSLYTNQPESSEEGATRRANFSLSGPLAGDALTTRLYGNLNKT
FT                   DADSWDINSPVGTKNAAGHEGVRNKDINGVISWKLNPQQILDFEAGYSRQGNIYAGDTQ
FT                   NSSSSAVTESLAKSGKETNRLYRQNYGITHNGIWDWGQSRFGIYYEKTNNTRMNEGLSG
FT                   GGEGRILAGEKFTTNRLSSWRTSGELNIPLNVMVDQTLTVGAEWNRDKLDDPSSTSLTV
FT                   NDRDISGISGSAADRSSKNHSQISALYIEDNIEPVPGTNIIPGLRFDYLSDSGGNFSPS
FT                   LNLSQELGDYFKVKAGVARTFKAPNLYQSSEGYLLYSKGNGCPKDITSGGCYLIGNKDL
FT                   DPEISVNKEIGLEFTWEDYHASVTYFRNDYQNKIVAGDNVIGQTASGAYILKWQNGGKA
FT                   LVDGIEASMSFPLVKDRLNWNTNATWMITSEQKDTGNPLSVIPKYTINNSLNWTITQAF
FT                   SANVNWTLYGRQKPRTHAETRSEDTGGLSGKELGAYSLVGTNFNYDINKNLRLNVGVSN
FT                   ILNKQIFRSSEGANTYNEPGRAYYAGVTASF"
     MRINKILWSL TVLLVGLNSQ VSVAKYSDDD NDETLVVEAT AEQVLKQQPG VSVITSEDIK        60
     KTPPVNDLSD IIRKMPGVNL TGNSASGTRG NNRQIDIRGM GPENTLILID GVPVTSRNSV       120
     RYSWRGERDT RGDTNWVPPE QVERIEVIRG PAAARYGSGA AGGVVNIITK RPTNDWHGSL       180
     SLYTNQPESS EEGATRRANF SLSGPLAGDA LTTRLYGNLN KTDADSWDIN SPVGTKNAAG       240
     HEGVRNKDIN GVISWKLNPQ QILDFEAGYS RQGNIYAGDT QNSSSSAVTE SLAKSGKETN       300
     RLYRQNYGIT HNGIWDWGQS RFGIYYEKTN NTRMNEGLSG GGEGRILAGE KFTTNRLSSW       360
     RTSGELNIPL NVMVDQTLTV GAEWNRDKLD DPSSTSLTVN DRDISGISGS AADRSSKNHS       420
     QISALYIEDN IEPVPGTNII PGLRFDYLSD SGGNFSPSLN LSQELGDYFK VKAGVARTFK       480
     APNLYQSSEG YLLYSKGNGC PKDITSGGCY LIGNKDLDPE ISVNKEIGLE FTWEDYHASV       540
     TYFRNDYQNK IVAGDNVIGQ TASGAYILKW QNGGKALVDG IEASMSFPLV KDRLNWNTNA       600
     TWMITSEQKD TGNPLSVIPK YTINNSLNWT ITQAFSANVN WTLYGRQKPR THAETRSEDT       660
     GGLSGKELGA YSLVGTNFNY DINKNLRLNV GVSNILNKQI FRSSEGANTY NEPGRAYYAG       720
     VTASF                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page