(data stored in ACNUC7421 zone)

EMBL: CP000247.PE303

CP000247.PE303       Location/Qualifiers
FT   CDS             complement(330479..330838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0308"
FT                   /product="transposase InsG for insertion sequence element
FT                   IS4"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G8"
FT                   /protein_id="ABG68343.1"
FT                   /translation="MQLSRLTLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYW
FT                   PNQLSFSESCGMVMRMLMTLQGASPGRIPELMRDLASMGQLVKLPTRRERAFPRVVKER
FT                   PWKYPTAPKKSQSVA"
     MQLSRLTLRS KKPELVEQEL WGVLLAYNLV RYQMIKMAEH LKGYWPNQLS FSESCGMVMR        60
     MLMTLQGASP GRIPELMRDL ASMGQLVKLP TRRERAFPRV VKERPWKYPT APKKSQSVA        119
//

If you have problems or comments...

PBIL Back to PBIL home page