(data stored in ACNUC7421 zone)

EMBL: CP000247.PE306

CP000247.PE306       Location/Qualifiers
FT   CDS             complement(333222..334031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68346"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1D5"
FT                   /protein_id="ABG68346.1"
FT                   /translation="MSLTSSPAQHAGLSIVKSSQSTAQVEGAYRLIRNPSVSPQAIAEA
FT                   GFTATVRACEAHPLLLALEDTTTINFSHSTASDDQGNTTTNPKTHGLLAHSVLMYAPDS
FT                   ALPVGFIEQQRWSRVTDTYGVKHQRKERPCEEKESYRWQQASERMAERLGEIQKRVITV
FT                   CDREADIWHYLHYKVSHGQRFVVRAAQNSRLEEAPGKLFELPEVLATAGSHTLNVMQKG
FT                   GRAARQARMFIRYSEVSIKIATTAARRSRSRMSVAGSSQRTVPAGIC"
     MSLTSSPAQH AGLSIVKSSQ STAQVEGAYR LIRNPSVSPQ AIAEAGFTAT VRACEAHPLL        60
     LALEDTTTIN FSHSTASDDQ GNTTTNPKTH GLLAHSVLMY APDSALPVGF IEQQRWSRVT       120
     DTYGVKHQRK ERPCEEKESY RWQQASERMA ERLGEIQKRV ITVCDREADI WHYLHYKVSH       180
     GQRFVVRAAQ NSRLEEAPGK LFELPEVLAT AGSHTLNVMQ KGGRAARQAR MFIRYSEVSI       240
     KIATTAARRS RSRMSVAGSS QRTVPAGIC                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page