(data stored in ACNUC7421 zone)

EMBL: CP000247.PE308

CP000247.PE308       Location/Qualifiers
FT   CDS             334467..336431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0314"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68348"
FT                   /db_xref="GOA:A0A454A1E0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1E0"
FT                   /protein_id="ABG68348.1"
FT                   /translation="MNVIRTVICTLIILPVGLQAATSHSSMVKDTITIVATGNQNTVFE
FT                   TPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVLVLVD
FT                   GVRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADFLPPGE
FT                   TNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGEHAPNKEKPA
FT                   ALFAKGSVGITDSNKAGASLRLYRNNTTEPGNSTQTHGDSGLRDRKTVQNDVQFWYQYA
FT                   PVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFPGAHQLSYG
FT                   AEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDRYKSFNPRAG
FT                   ELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRKGKPNYWVPNL
FT                   NLKPENNITREIGAGIQLDGLLTDNDRLQLKGGYFGTDARNYIATRVDMKRMRSYSYNV
FT                   SRARIWGWDMQGNYQSDYVDWMLSYNRTESMDASSREWLGSGNPDTLISDISIPVGHRG
FT                   VYAGWRAELSASATHVKKGDPHQAGYTIHSFSLSYKPVSVKGFEASVTLDNAFNKLAMN
FT                   GKGVPLSGRTVSLYTRYQW"
     MNVIRTVICT LIILPVGLQA ATSHSSMVKD TITIVATGNQ NTVFETPSMV SVVTNDTPWS        60
     QNAVTSAGML KGVAGLSQTG AGRTNGQTFN LRGYDKSGVL VLVDGVRQLS DMAKSSGTYL       120
     DPALVKRIEV VRGPNSSLYG SGGLGGVVDF RTADAADFLP PGETNGLSLW GNIASGDHST       180
     GSGLTWFGKT GKTDALLSVI MRKRGNIYQS DGEHAPNKEK PAALFAKGSV GITDSNKAGA       240
     SLRLYRNNTT EPGNSTQTHG DSGLRDRKTV QNDVQFWYQY APVDNSLINV KSTLYLSDIT       300
     IKTNGHNKTA EWRNNRTSGV NVVNRSHTLI FPGAHQLSYG AEYYRQQQKP EGSATLYPEG       360
     NIDFTSLYFQ DEMTMKSYPV NIIVGSRYDR YKSFNPRAGE LKAERLSPRA AISVSPTDWL       420
     MMYGSISSAF RAPTMAEMYR DDVHFYRKGK PNYWVPNLNL KPENNITREI GAGIQLDGLL       480
     TDNDRLQLKG GYFGTDARNY IATRVDMKRM RSYSYNVSRA RIWGWDMQGN YQSDYVDWML       540
     SYNRTESMDA SSREWLGSGN PDTLISDISI PVGHRGVYAG WRAELSASAT HVKKGDPHQA       600
     GYTIHSFSLS YKPVSVKGFE ASVTLDNAFN KLAMNGKGVP LSGRTVSLYT RYQW             654
//

If you have problems or comments...

PBIL Back to PBIL home page