(data stored in ACNUC7421 zone)

EMBL: CP000247.PE317

CP000247.PE317       Location/Qualifiers
FT   CDS             complement(342066..342251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1E9"
FT                   /protein_id="ABG68357.1"
FT                   /translation="MTISSMIHAEHALSMSAPGTKRTVGRPARSAMSAQQKFATVYSEE
FT                   SVVLTLPRIYEWVSVN"
     MTISSMIHAE HALSMSAPGT KRTVGRPARS AMSAQQKFAT VYSEESVVLT LPRIYEWVSV        60
     N                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page