(data stored in ACNUC7421 zone)

EMBL: CP000247.PE320

CP000247.PE320       Location/Qualifiers
FT   CDS             complement(345442..346164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0326"
FT                   /product="putative regulatory helix-turn-helix protein,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68360"
FT                   /db_xref="GOA:A0A454A1G7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G7"
FT                   /protein_id="ABG68360.1"
FT                   /translation="MRLYMTVFSFIKEVLSPHIRLLYSPQELGFNDAGLIVLNHFGYDN
FT                   NIYYSVTLTRKEITSFQNTSENTHYFAYSKTIKKTIDRIFKITGEKITIGNITPSINGK
FT                   VSVTLILSLLEMKLIDFIADDNTDVRVRLTVLNMLNNNTTTIRELAASVYLQEDYLKRI
FT                   FRRYTGTGLYQFYNWIKLLKAISKIQNNDKIKKIAIELGYSSSSSFNYSFKKEFSIGPR
FT                   DYIKEYLHNKISCMAVHE"
     MRLYMTVFSF IKEVLSPHIR LLYSPQELGF NDAGLIVLNH FGYDNNIYYS VTLTRKEITS        60
     FQNTSENTHY FAYSKTIKKT IDRIFKITGE KITIGNITPS INGKVSVTLI LSLLEMKLID       120
     FIADDNTDVR VRLTVLNMLN NNTTTIRELA ASVYLQEDYL KRIFRRYTGT GLYQFYNWIK       180
     LLKAISKIQN NDKIKKIAIE LGYSSSSSFN YSFKKEFSIG PRDYIKEYLH NKISCMAVHE       240
//

If you have problems or comments...

PBIL Back to PBIL home page