(data stored in ACNUC7421 zone)

EMBL: CP000247.PE325

CP000247.PE325       Location/Qualifiers
FT   CDS             351386..352258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68365"
FT                   /db_xref="GOA:A0A454A1H5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1H5"
FT                   /protein_id="ABG68365.1"
FT                   /translation="MNPSDAIEAIEKPLSSLPYSLSRHILEHLRKLTSHEPVIGIMGKS
FT                   GAGKSSLCNALFQGEVTPVSDVHAGTREVQRFRLSGHGHSMVITDLPGVGESRDRDAEY
FT                   EALYRDILPELDLVLWLIKADDRALSVDEYFWRHILQRGHQQVLFVVTQADKTEPCHEW
FT                   DVAGIQPSPAQAQNIREKTEAVFRLFRPVHPVVAVSARTGWELDTLVSALMTALPDHAA
FT                   SPLMTRLQDELRTESVRAQAREQFTGAVDRIFDTAESVCVASVARTVLRAVRDTVGSVA
FT                   RAVWNWIFF"
     MNPSDAIEAI EKPLSSLPYS LSRHILEHLR KLTSHEPVIG IMGKSGAGKS SLCNALFQGE        60
     VTPVSDVHAG TREVQRFRLS GHGHSMVITD LPGVGESRDR DAEYEALYRD ILPELDLVLW       120
     LIKADDRALS VDEYFWRHIL QRGHQQVLFV VTQADKTEPC HEWDVAGIQP SPAQAQNIRE       180
     KTEAVFRLFR PVHPVVAVSA RTGWELDTLV SALMTALPDH AASPLMTRLQ DELRTESVRA       240
     QAREQFTGAV DRIFDTAESV CVASVARTVL RAVRDTVGSV ARAVWNWIFF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page