(data stored in ACNUC7421 zone)

EMBL: CP000247.PE327

CP000247.PE327       Location/Qualifiers
FT   CDS             356041..356859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68367"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G0"
FT                   /protein_id="ABG68367.1"
FT                   /translation="MRLASRFGYANQVRRDRPLTHEELMRHVPSIFGEDRHTSRSEHYA
FT                   YIPTITVLENLQQEGFQPFFACQTRVRDPGRRGYTKHMLRLRRNGEINGQHVPEIILLN
FT                   SHDGTSSYQMLPGYFRFVCQNGCVCGQSLGEVHVPHRGNVVDRVIEGAHEVVGVFDRIE
FT                   EKRDAMQSLVLPPPARQALAQAALTYRYGDEHQPVTTADILTPRRREDYGKDLWSAYQT
FT                   IQENMLKGGISGRSAKGKRIHTRAIHSIDTDIKLNRALWVMAETLLESMR"
     MRLASRFGYA NQVRRDRPLT HEELMRHVPS IFGEDRHTSR SEHYAYIPTI TVLENLQQEG        60
     FQPFFACQTR VRDPGRRGYT KHMLRLRRNG EINGQHVPEI ILLNSHDGTS SYQMLPGYFR       120
     FVCQNGCVCG QSLGEVHVPH RGNVVDRVIE GAHEVVGVFD RIEEKRDAMQ SLVLPPPARQ       180
     ALAQAALTYR YGDEHQPVTT ADILTPRRRE DYGKDLWSAY QTIQENMLKG GISGRSAKGK       240
     RIHTRAIHSI DTDIKLNRAL WVMAETLLES MR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page