(data stored in ACNUC7421 zone)

EMBL: CP000247.PE328

CP000247.PE328       Location/Qualifiers
FT   CDS             356951..357436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0334"
FT                   /product="possible anti-restriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68368"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G4"
FT                   /protein_id="ABG68368.1"
FT                   /translation="MTTSSHNSTTPSVSVTTASGNNQSQLVATPVPDEQRISFWPQHFG
FT                   LIPQWVTLEPRVFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDGDDDETWVLFNAMN
FT                   GNRAEMSPEAAGIAACLMTYSHHACRTECYVMTVHYYRLRDYALQHPECSAIMRIID"
     MTTSSHNSTT PSVSVTTASG NNQSQLVATP VPDEQRISFW PQHFGLIPQW VTLEPRVFGW        60
     MDRLCEDYCG GIWNLYTLNN GGAFMAPEPD GDDDETWVLF NAMNGNRAEM SPEAAGIAAC       120
     LMTYSHHACR TECYVMTVHY YRLRDYALQH PECSAIMRII D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page