(data stored in ACNUC7421 zone)

EMBL: CP000247.PE33

CP000247.PE33        Location/Qualifiers
FT   CDS             complement(35568..35786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0033"
FT                   /product="hypothetical protein YaaV"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0U3"
FT                   /protein_id="ABG68075.1"
FT                   /translation="MTRFAAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
     MTRFAAIKQG HIKIVDISIV CNFTVDKCEL NPAYVIKNID SPKDLLNGQK KRSSSENRIS        60
     YSIKLADEKY PP                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page