(data stored in ACNUC7421 zone)

EMBL: CP000247.PE334

CP000247.PE334       Location/Qualifiers
FT   CDS             359668..359910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68374"
FT                   /db_xref="InterPro:IPR009301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1E7"
FT                   /protein_id="ABG68374.1"
FT                   /translation="MPAGFTHFQLVTRNNMKSLTTETALDILIAWLQDNIDCESGIIFD
FT                   NDEDKTDSAALLPCIEQAREDIRTLHQLQFLQQNW"
     MPAGFTHFQL VTRNNMKSLT TETALDILIA WLQDNIDCES GIIFDNDEDK TDSAALLPCI        60
     EQAREDIRTL HQLQFLQQNW                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page