(data stored in ACNUC7421 zone)

EMBL: CP000247.PE34

CP000247.PE34        Location/Qualifiers
FT   CDS             35821..36216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0034"
FT                   /product="transcriptional activatory protein CaiF"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68076"
FT                   /db_xref="GOA:A0A454A0V3"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0V3"
FT                   /protein_id="ABG68076.1"
FT                   /translation="MCEGCVEKPLYLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTL
FT                   TYILSEVTEISCEVKMIPNKLEGRGCQCQRLVKVVDIDEQIYARLRNNSRDKLVGVRKT
FT                   PRIPAVPLTELNREQKWQMMLSKSMRR"
     MCEGCVEKPL YLLIAEWMMA ENRWVIAREI SIHFDIEHSK AVNTLTYILS EVTEISCEVK        60
     MIPNKLEGRG CQCQRLVKVV DIDEQIYARL RNNSRDKLVG VRKTPRIPAV PLTELNREQK       120
     WQMMLSKSMR R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page