(data stored in ACNUC7421 zone)

EMBL: CP000247.PE340

CP000247.PE340       Location/Qualifiers
FT   CDS             complement(368508..368711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1I5"
FT                   /protein_id="ABG68380.1"
FT                   /translation="MITANVLLITPPSTKSVRTSNDAIRKYIKKTVVINEDGKQCVKTN
FT                   LNFRKTDDGMVIYISALNRHAI"
     MITANVLLIT PPSTKSVRTS NDAIRKYIKK TVVINEDGKQ CVKTNLNFRK TDDGMVIYIS        60
     ALNRHAI                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page