(data stored in ACNUC7421 zone)

EMBL: CP000247.PE343

CP000247.PE343       Location/Qualifiers
FT   CDS             369890..370075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68383"
FT                   /db_xref="GOA:A0A454A1J9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1J9"
FT                   /protein_id="ABG68383.1"
FT                   /translation="MASGLICHGGFKPHAWGVASLMDVTVLVVASLLVWLLVNRENHYA
FT                   RGIPQDVQVLHKKAHH"
     MASGLICHGG FKPHAWGVAS LMDVTVLVVA SLLVWLLVNR ENHYARGIPQ DVQVLHKKAH        60
     H                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page