(data stored in ACNUC7421 zone)

EMBL: CP000247.PE344

CP000247.PE344       Location/Qualifiers
FT   CDS             370290..370904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0350"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68384"
FT                   /db_xref="GOA:A0A454A1F5"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1F5"
FT                   /protein_id="ABG68384.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNSAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     MNIFEQTPPN RRRYGLAAFI GLIAGVVSAF VKWGAEVPLP PRSPVDMFNA ACGPESLIRA        60
     AGQIDCSRNF LNPPYIFLRD WLGLTDPNSA VYTFAGHVFN WVGVTHIIFS IVFAVGYCVV       120
     AEVFPKIKLW QGLLAGALAQ LFVHMISFPL MGLTPPLFDL PWYENVSEIF GHLVWFWSIE       180
     IIRRDLRNRI THEPDPEIPL GSNR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page