(data stored in ACNUC7421 zone)

EMBL: CP000247.PE351

CP000247.PE351       Location/Qualifiers
FT   CDS             complement(378039..378581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0357"
FT                   /product="hypothetical protein YkgK"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68391"
FT                   /db_xref="GOA:Q0TKZ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKZ0"
FT                   /protein_id="ABG68391.1"
FT                   /translation="MECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDF
FT                   VFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLS
FT                   RDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTH
FT                   RRNAEAKLYSKLYKLVQ"
     MECQNRSDKY IWSPHDAYFY KGLSELIVDI DRLIYLSLEK IRKDFVFINL NTDSLTEFIN        60
     RDNEWLSAVK GKQVVLIAAR KSEALANYWY YNSNIRGVVY AGLSRDIRKE LAYVINGRFL       120
     RKDIKKDKIT DREMEIIRMT AQGMLPKSIA RIENCSVKTV YTHRRNAEAK LYSKLYKLVQ       180
//

If you have problems or comments...

PBIL Back to PBIL home page