(data stored in ACNUC7421 zone)

EMBL: CP000247.PE353

CP000247.PE353       Location/Qualifiers
FT   CDS             complement(379665..379805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0359"
FT                   /product="putative 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68393"
FT                   /db_xref="GOA:Q0TKY8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKY8"
FT                   /protein_id="ABG68393.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
     MKVLNSLRTA KERHPDCQIV KRKGRLYVIC KSNPRFKAVQ GRKKKR                       46
//

If you have problems or comments...

PBIL Back to PBIL home page