(data stored in ACNUC7421 zone)

EMBL: CP000247.PE364

CP000247.PE364       Location/Qualifiers
FT   CDS             complement(394387..394980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0370"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68404"
FT                   /db_xref="GOA:A0A454A1H6"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1H6"
FT                   /protein_id="ABG68404.1"
FT                   /translation="MERYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQHLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARHILKQRSNESSSTLKTEY"
     MERYLHLLSR GDKIGLTLIR LSIAIVFMWI GLLKFVPYEA DSITPFVANS PLMSFFYEHP        60
     EDYKQHLTHE GEYKPEARAW QTANNTYGFS NGLGVVEVII ALLVLANPVN RWLGLLGGLM       120
     AFTTPLVTLS FLITTPEAWV PALGDAHHGF PYLSGAGRLV LKDTLMLAGA VMIMADSARH       180
     ILKQRSNESS STLKTEY                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page