(data stored in ACNUC7421 zone)

EMBL: CP000247.PE371

CP000247.PE371       Location/Qualifiers
FT   CDS             complement(401189..401386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68411"
FT                   /db_xref="GOA:A0A454A1M3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M3"
FT                   /protein_id="ABG68411.1"
FT                   /translation="MNTNKTLGSNKQHSDRECLYKTIVTVTGKGARLQEWIPVFLTVNI
FT                   LALLMSGYLQKSSITMTERG"
     MNTNKTLGSN KQHSDRECLY KTIVTVTGKG ARLQEWIPVF LTVNILALLM SGYLQKSSIT        60
     MTERG                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page