(data stored in ACNUC7421 zone)

EMBL: CP000247.PE375

CP000247.PE375       Location/Qualifiers
FT   CDS             complement(405464..406258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68415"
FT                   /db_xref="GOA:A0A454A1M4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M4"
FT                   /protein_id="ABG68415.1"
FT                   /translation="MKKPLVIISACQFTRLALESLIPTDRYIVRVYSNVTTEVEFVLKT
FT                   SCGYLLADIPSLPSGELVLLACLARLRSDAGQWQVCLTGDSDWFDNAPAASLYNGFPRI
FT                   GTMLTASRYQNQIIRWLLRPLPGDMSDFWLLTARELSVLKILMQGMSFSEIARYEQRSS
FT                   KTLHAIATRALMKLGLGTLSDFRLLYTGCGDSRVKRNIRLHAKYIGQHSAHRLTQYVQN
FT                   MVSGILYPEKVAVGESINSDAISGKVLSGQRKNMSKKRPGLL"
     MKKPLVIISA CQFTRLALES LIPTDRYIVR VYSNVTTEVE FVLKTSCGYL LADIPSLPSG        60
     ELVLLACLAR LRSDAGQWQV CLTGDSDWFD NAPAASLYNG FPRIGTMLTA SRYQNQIIRW       120
     LLRPLPGDMS DFWLLTAREL SVLKILMQGM SFSEIARYEQ RSSKTLHAIA TRALMKLGLG       180
     TLSDFRLLYT GCGDSRVKRN IRLHAKYIGQ HSAHRLTQYV QNMVSGILYP EKVAVGESIN       240
     SDAISGKVLS GQRKNMSKKR PGLL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page