(data stored in ACNUC7421 zone)

EMBL: CP000247.PE382

CP000247.PE382       Location/Qualifiers
FT   CDS             complement(411406..412011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0388"
FT                   /product="TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68422"
FT                   /db_xref="GOA:Q0TKV9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKV9"
FT                   /protein_id="ABG68422.1"
FT                   /translation="MNGVAKMPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRA
FT                   GVSTGIISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAELRLQAIVGGNFDE
FT                   TQVSSAAMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRQQAQEAGYGL
FT                   AALIDGLWLRAALSGKPLDKPLAHSLTRHFITQHLSTD"
     MNGVAKMPKL GMQSIRRRQL IDATLEAINE VGMHDATIAQ IARRAGVSTG IISHYFRDKN        60
     GLLEATMRDI TSQLRDAVLN RLHALPQGSA ELRLQAIVGG NFDETQVSSA AMKAWLAFWA       120
     SSMHQPMLYR LQQVSSRRLL SNLVSEFRRE LPRQQAQEAG YGLAALIDGL WLRAALSGKP       180
     LDKPLAHSLT RHFITQHLST D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page