(data stored in ACNUC7421 zone)

EMBL: CP000247.PE387

CP000247.PE387       Location/Qualifiers
FT   CDS             complement(417185..417682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0393"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68427"
FT                   /db_xref="GOA:A0A454A1M2"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M2"
FT                   /protein_id="ABG68427.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIKSLAVNYSGMVWAFFAALAAGWLAPVSGLSAFWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKSD
FT                   GY"
     MNGLTATGVT VGICAGLWQL VSSHVGLSQG WELLGTIGFV AFCSFYAAGG GKSGFIKSLA        60
     VNYSGMVWAF FAALAAGWLA PVSGLSAFWA SVITTVPFSA VVVWQGRFWL LSFIPGGFLG       120
     MTLFFASGMN WTVTLLGFLA GNCVGIISEY GGQKLSEATT KSDGY                       165
//

If you have problems or comments...

PBIL Back to PBIL home page