(data stored in ACNUC7421 zone)

EMBL: CP000247.PE388

CP000247.PE388       Location/Qualifiers
FT   CDS             417759..418001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1L7"
FT                   /protein_id="ABG68428.1"
FT                   /translation="MKGYRVKETNIALPHTAKRLLNIIQQKGEIRRIKFKRVLLSDYRC
FT                   YSQFIENSHKNQGNVNDYKKSTCRLFIGCTTGRYR"
     MKGYRVKETN IALPHTAKRL LNIIQQKGEI RRIKFKRVLL SDYRCYSQFI ENSHKNQGNV        60
     NDYKKSTCRL FIGCTTGRYR                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page