(data stored in ACNUC7421 zone)

EMBL: CP000247.PE390

CP000247.PE390       Location/Qualifiers
FT   CDS             418585..419448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0396"
FT                   /product="hypothetical protein YahE"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68430"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M9"
FT                   /protein_id="ABG68430.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFNGLFRHGDKVQFDDQGITVGQHLHIEMSHCQRWLSPTLQMTALNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLVLILFISGHPAEKYKEEFYRGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     MWALTADADF LAQRGQGQVE QVFARAVNIA LPARQQLLTL LCEEYDNAPN SCRLALTHFN        60
     GLFRHGDKVQ FDDQGITVGQ HLHIEMSHCQ RWLSPTLQMT ALNFHLIAWQ QWHDIIHQHL       120
     GENETLFNYR GDNPFYQALN KELHIKRRAV IQAVNDKQNI ASAVASMMGL GIGLTPSADD       180
     YLTGLVLILF ISGHPAEKYK EEFYRGLQRG RNNTTLLSAI TLEAALQQRC RENIHRFIHN       240
     IIYDIPGNAT QAIEKIKHIG SSSGCDMLYG MADGCALSQT YGGNYVS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page