(data stored in ACNUC7421 zone)

EMBL: CP000247.PE391

CP000247.PE391       Location/Qualifiers
FT   CDS             419438..420985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0397"
FT                   /product="YahF/FdrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68431"
FT                   /db_xref="GOA:A0A454A1P2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1P2"
FT                   /protein_id="ABG68431.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGVDNEQLLAEIEELFNTKAQSGSHEARYATI
FT                   ASAKKYIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIVLISKPPAPAVARKVLERARACRKPVVAC
FT                   FLGRGETSVDEQGLQFARGSKEAALKAVMLSGVKQEHLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETLFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     MSVKIVIKPN TYFDSVSLMS ISTRANKLDG VEQAFVAMAT EMNKGVLKNL GLLTPELEQA        60
     KNGDLMIVIN GKSGVDNEQL LAEIEELFNT KAQSGSHEAR YATIASAKKY IPESNLAVIS       120
     VNGLFAAREA RQALQNDLNV MLFSDNVSVE DELALKQLAH EKGLLMMGPD CGTAIINGAA       180
     LCFGNAVRRG NIGIVGASGT GSQELSVRIH EFGGGVSQLI GTGGRDLSEK IGGLMMLDAI       240
     GMLENDPQTE IIVLISKPPA PAVARKVLER ARACRKPVVA CFLGRGETSV DEQGLQFARG       300
     SKEAALKAVM LSGVKQEHLD LHTLNQPLIA DVRARLQPQQ KYIRGLFCGG TLCDETLFAV       360
     MEKHGDVYSN IQPDPEFRLQ DINRSIKHTF LDFGDDDFTN GKPHPMIDPT NRISRLIEEA       420
     RDPEVAVIVM DFVLGFGSHE DPVGSTIEAI KEAKAIAAAE GRELIILAYV LGTDLDTPSL       480
     EQQSQMLLDA GVILASSSTN TGLLAREFIC KGEEA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page