(data stored in ACNUC7421 zone)

EMBL: CP000247.PE394

CP000247.PE394       Location/Qualifiers
FT   CDS             423610..424992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0400"
FT                   /product="hypothetical protein YahJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68434"
FT                   /db_xref="GOA:A0A454A1K4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1K4"
FT                   /protein_id="ABG68434.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGPSVPLAHAGVAGTLNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKQHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFKCEIVAFPQHGL
FT                   LLSKSESLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   AGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDKLAHRMVAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     MKENNSRREF LSQSGKMVTA AALFGPSVPL AHAGVAGTLN CEANNTMKIT DPHYYLDNVL        60
     LETGFDYENG VAVQTRTARQ TVEIQDGKIV ALRENKQHPD ATLPHYDAGG KLMLPTTRDM       120
     HIHLDKTFYG GPWRSLNRPA GTTIQDMIKL EQKMLPELQP YTQERAEKLI DLLQSKGTTI       180
     ARSHCNIEPV SGLKNLQNLQ AVLARRQAGF KCEIVAFPQH GLLLSKSESL MREAMQAGAH       240
     YVGGLDPTSV DGAMEKSLDT MFQIALDYDK GVDIHLHETT PAGVAAINYM VETVEKTPQL       300
     KGKLTISHAF ALATLNEQQV DKLAHRMVAQ QISIASTVPI GTLHMPLKQL HDKGVKVMTG       360
     TDSVIDHWSP YGLGDMLEKA NLYAQLYIRP NEQNLSRSLF LATGDVLPLN EKGERVWPKA       420
     QDDASFVLVD ASCSAEAVAR ISPRTATFHK GQLVWGSVAG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page