(data stored in ACNUC7421 zone)

EMBL: CP000247.PE41

CP000247.PE41        Location/Qualifiers
FT   CDS             43946..44716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0041"
FT                   /product="probable flavoprotein subunit, carnitine
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68083"
FT                   /db_xref="GOA:Q0TLU8"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLU8"
FT                   /protein_id="ABG68083.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAVEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASVL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     MKIITCYKCV PDEQDIAVNN ADGSLDFSKA DAKISQYDLN AIEAACQLKQ QAVEAQVTAL        60
     SVGGKALTNA KGRKDVLSRG PDELIVVIDD QFEQALPQQT ASVLAAAAQK AGFDLILCGD       120
     GSSDLYAQQV GLLVGEILNI PAVNGVSKII SLTADTLTVE RELEDETETL SIPLPAVVAV       180
     STDINSPQIP SMKAILGAAK KPVQVWSAAD IGFNAEAAWS EQQVAAPKQR ERQRIVIEGD       240
     GEEQIAAFAE NLRKVI                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page