(data stored in ACNUC7421 zone)

EMBL: CP000247.PE416

CP000247.PE416       Location/Qualifiers
FT   CDS             complement(450130..450903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0423"
FT                   /product="hypothetical protein YaiO"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68456"
FT                   /db_xref="InterPro:IPR016504"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1N7"
FT                   /protein_id="ABG68456.1"
FT                   /translation="MIKRTLLAAAIFSTLPAYAGLTSITAGYDFTDYSGDHGNRNLAYA
FT                   ELVAKVENATLLFNLSQGRRDYGTEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVF
FT                   ARQDFRQDINLALLPKTLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVISSYRYTHYDS
FT                   SDAGGSYSNMISVRLNDPRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPL
FT                   TEQLNLGLTAGKVWYDTPTDDYNGLQLAAHLTWKF"
     MIKRTLLAAA IFSTLPAYAG LTSITAGYDF TDYSGDHGNR NLAYAELVAK VENATLLFNL        60
     SQGRRDYGTE HFNATRGQGA VWYKWNNWLT TRTGIAFADN TPVFARQDFR QDINLALLPK       120
     TLFTTGYRYT KYYDDVEVDA WQGGVSLYTG PVISSYRYTH YDSSDAGGSY SNMISVRLND       180
     PRGTGYTQLW LSRGTGAYTY DWTPETRYGS MKSVSLQRIQ PLTEQLNLGL TAGKVWYDTP       240
     TDDYNGLQLA AHLTWKF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page