(data stored in ACNUC7421 zone)

EMBL: CP000247.PE419

CP000247.PE419       Location/Qualifiers
FT   CDS             complement(452670..453341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0426"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68459"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1N8"
FT                   /protein_id="ABG68459.1"
FT                   /translation="MDKVLDSAILSSANKRKGILAIGAHPDDIELGCGASLARLAQKGI
FT                   YIATVVMTTGNSGVDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALEN
FT                   IIKNQIPSDVEIIRVYTMHDADRHQDHLAVYQASMVACRAIPQILGYETPSTWLSFMPQ
FT                   VFESVKEEYFSLKLTALKKHKSQSQRDYMRPERLRAVAQFRGQQVNSDLGEGFVIHKMI
FT                   L"
     MDKVLDSAIL SSANKRKGIL AIGAHPDDIE LGCGASLARL AQKGIYIATV VMTTGNSGVD        60
     GIIDRHEESR NALKILGCHQ TIHLNFADTR AHLQLNDMIS ALENIIKNQI PSDVEIIRVY       120
     TMHDADRHQD HLAVYQASMV ACRAIPQILG YETPSTWLSF MPQVFESVKE EYFSLKLTAL       180
     KKHKSQSQRD YMRPERLRAV AQFRGQQVNS DLGEGFVIHK MIL                         223
//

If you have problems or comments...

PBIL Back to PBIL home page