(data stored in ACNUC7421 zone)

EMBL: CP000247.PE422

CP000247.PE422       Location/Qualifiers
FT   CDS             454925..455692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0429"
FT                   /product="taurine transport ATP-binding protein TauB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68460"
FT                   /db_xref="GOA:Q0TKS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKS1"
FT                   /protein_id="ABG68460.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKGIQGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGVEKMQ
FT                   RLEIAHQMVKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     MLQISHLYAD YGGKPALEDI NLTLESGELL VVLGPSGCGK TTLLNLIAGF VPYQHGSIQL        60
     AGKGIQGPGA ERGVVFQNEG LLPWRNVQDN VAFGLQLAGV EKMQRLEIAH QMVKKVGLEG       120
     AEKRYIWQLS GGQRQRVGIA RALAANPQLL LLDEPFGALD AFTRDQMQTL LLKLWQETGK       180
     QVLLITHDIE EAVFMATELV LLSPGPGRVL ERLPLNFARR FVAGESSRSI KSDPQFIAMR       240
     EYVLSRVFEQ REAFS                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page