(data stored in ACNUC7421 zone)

EMBL: CP000247.PE427

CP000247.PE427       Location/Qualifiers
FT   CDS             461977..462600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0434"
FT                   /product="hypothetical protein YaiV"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68465"
FT                   /db_xref="GOA:A0A454A1R0"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R0"
FT                   /protein_id="ABG68465.1"
FT                   /translation="MLSVVKPLQEFGKLDKCLSRNGTRFEFNNEKQVIFSSDVNSEDTF
FT                   VILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISEGNCTGYHLPAKQTIT
FT                   LIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLSMIDWNEELRSRIGVM
FT                   NYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY"
     MLSVVKPLQE FGKLDKCLSR NGTRFEFNNE KQVIFSSDVN SEDTFVILEG VISLRREENV        60
     LIGITQAPYI MGLADGLMKN DIPYKLISEG NCTGYHLPAK QTITLIEQNQ LWRDAFYWLA       120
     WQNRILELRD VQLIGHNSYE QIRATLLSMI DWNEELRSRI GVMNYIHQRT RISRSVVAEV       180
     LAALRKGGYI EMNKGKLVAI NRLPSEY                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page