(data stored in ACNUC7421 zone)

EMBL: CP000247.PE434

CP000247.PE434       Location/Qualifiers
FT   CDS             468857..469117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0441"
FT                   /product="hypothetical protein YaiB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68472"
FT                   /db_xref="GOA:Q0TKQ9"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKQ9"
FT                   /protein_id="ABG68472.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLRHPRQ"
     MKNLIAELLF KLAQKEEESK ELCAQVEALE IIVTAMLRNM AQNDQQRLID QVEGALYEVK        60
     PDASIPDDDT ELLRDYVKKL LRHPRQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page