(data stored in ACNUC7421 zone)

EMBL: CP000247.PE437

CP000247.PE437       Location/Qualifiers
FT   CDS             471174..472289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0444"
FT                   /product="hypothetical protein YaiC"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68475"
FT                   /db_xref="GOA:A0A454A1R7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R7"
FT                   /protein_id="ABG68475.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPSPGWWWLLLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNALPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
     MFPKIMNDEN FFKKAAAHGE EPPLTPQNEH QRSGLRFARR VRLPRAVGLA GMFLPIASTL        60
     VSHPSPGWWW LLLVGWAFVW PHLAWQIASR AVDPLSREIY NLKTDAVLAG MWVGVMGVNA       120
     LPSTAMLMIM CLNLMGAGGP RLFVAGLVLM VVSCLVTLEL TGITVSFNSA PLEWWLSLPI       180
     IVIYPLLFGW VSYQTATKLA EHKRRLQVMS TRDGMTGVYN RRHWETMLRN EFDNCRRHNR       240
     DATLLIIDID HFKSINDTWG HDVGDEAIVA LTRQLQITLR GSDVIGRFGG DEFAVIMSGT       300
     PAESAITAML RVHEGLNTLR LPNTPQVTLR ISVGVAPLNP QMSHYREWLK SADLALYKAK       360
     KAGRNRTEVA A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page