(data stored in ACNUC7421 zone)

EMBL: CP000247.PE439

CP000247.PE439       Location/Qualifiers
FT   CDS             473235..473693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0446"
FT                   /product="hypothetical UPF0178 protein YaiI"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68477"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKQ4"
FT                   /protein_id="ABG68477.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
     MTIWVDADAC PNVIKEILYR AAERMQMPLV LVANQSLRVP PSRFIRTLRV AAGFDVADNE        60
     IVRQCEAGDL VITADIPLAA EAIEKGAAAL NPRGERYTPA TIRERLTMRD FMDTLRASGI       120
     QTGGPDSLSQ RDRQAFAAEL EKWWLEVQRS RG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page