(data stored in ACNUC7421 zone)

EMBL: CP000247.PE442

CP000247.PE442       Location/Qualifiers
FT   CDS             474672..474851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1S1"
FT                   /protein_id="ABG68480.1"
FT                   /translation="MPPQGICVTFFTIHVFQIIRILNNNNPLLESFGIFTLCSAGLLLR
FT                   FLSFVAQVSVSSGA"
     MPPQGICVTF FTIHVFQIIR ILNNNNPLLE SFGIFTLCSA GLLLRFLSFV AQVSVSSGA         59
//

If you have problems or comments...

PBIL Back to PBIL home page