(data stored in ACNUC7421 zone)

EMBL: CP000247.PE448

CP000247.PE448       Location/Qualifiers
FT   CDS             complement(478792..479976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0455"
FT                   /product="putative sugar transport protein AraJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68486"
FT                   /db_xref="GOA:A0A454A1Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Q9"
FT                   /protein_id="ABG68486.1"
FT                   /translation="MKKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMIS
FT                   YYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFP
FT                   HGAFFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLI
FT                   AVFNIAVMASVYFWVPDIRDEAKGKLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYV
FT                   KPYMMFISGFSETAMTFIMMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLM
FT                   LFFFGGMKTTSLIFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAVG
FT                   AYCGGMMLTLGLAYNYVALPAALLSFAAMSSLLLYGRYKRQQAADSSVLAKPLG"
     MKKVILSLAL GTFGLGMAEF GIMGVLTELA HNVGISIPAA GHMISYYALG VVVGAPIIAL        60
     FSSRYSLKHI LLFLVALCVI GNAMFTLSSS YLMLAIGRLV SGFPHGAFFG VGAIVLSKII       120
     KPGKVTAAVA GMVSGMTVAN LLGIPLGTYL SQEFSWRYTF LLIAVFNIAV MASVYFWVPD       180
     IRDEAKGKLR EQFHFLRSPA PWLIFAATMF GNAGVFAWFS YVKPYMMFIS GFSETAMTFI       240
     MMLVGLGMVL GNMLSGRISG RYSPLRIAAV TDFIIVLALL MLFFFGGMKT TSLIFAFICC       300
     AGLFALSAPL QILLLQNAKG GELLGAAGGQ IAFNLGSAVG AYCGGMMLTL GLAYNYVALP       360
     AALLSFAAMS SLLLYGRYKR QQAADSSVLA KPLG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page